Recombinant Proteins
Modified or manipulated proteins encoded by recombinant DNA and suitable for a variety of purposes including the modification of gene sequences, mass protein production, and the manufacture of commercial products.
For Use With (Application)
- (2)
- (970)
- (1)
- (23,544)
- (5)
- (1)
- (1)
- (67)
- (219)
- (4,425)
- (23)
- (1)
- (4)
- (2)
- (13)
- (21,464)
- (3)
- (4)
- (3)
- (1)
- (2)
- (4)
- (14)
- (71)
- (2)
- (2)
- (2)
- (1)
- (3)
- (2)
- (1)
- (3)
- (4)
- (1)
- (1)
- (1)
- (3)
- (254)
- (22,607)
- (1)
- (1)
- (2)
- (1)
- (13)
- (26,167)
- (266)
- (32)
- (3)
- (708)
- (14)
- (2)
- (1)
- (8)
- (1)
- (5)
- (1)
- (108)
- (1)
- (3,783)
- (1,408)
- (3)
- (4)
- (2)
- (5)
- (1)
- (1)
- (1)
- (1)
- (14)
- (137)
- (48)
- (6)
- (17)
- (2)
- (1)
- (4)
- (82)
- (12)
- (2)
- (3)
- (80)
- (4)
- (113)
- (96)
- (19)
- (1)
- (1)
- (4)
- (1)
- (1,525)
- (2)
- (1)
- (3)
- (18)
- (48)
- (3)
- (1)
- (2)
- (9)
- (27)
- (2)
- (198)
- (1)
- (4)
- (1)
- (2)
- (114)
- (44)
- (2)
- (1)
- (1)
- (4)
- (1)
- (1)
- (3)
- (1)
- (23,710)
- (6)
- (3)
- (1)
- (1)
- (63)
- (6)
- (2)
- (7)
- (5)
- (1)
- (2)
- (1)
- (1)
- (6,726)
- (6)
- (4)
- (1)
- (3)
- (1)
- (3)
- (2)
- (13)
- (17)
- (1)
- (3)
- (3)
- (4)
- (25,927)
- (240)
- (1)
- (3)
Recombinant
- (286)
- (2)
- (61,759)
- (1)
Form
- (15)
- (1)
- (2)
- (45,219)
- (5,704)
- (245)
- (168)
- (56)
- (3,364)
Species
- (2)
- (1)
- (2)
- (1)
- (21)
- (559)
- (96)
- (2)
- (1)
- (1)
- (2)
- (1)
- (27)
- (1)
- (8)
- (15)
- (1)
- (72)
- (1)
- (1,050)
- (1)
- (3)
- (16)
- (1)
- (3)
- (1)
- (1)
- (1)
- (8)
- (1)
- (4)
- (1)
- (1)
- (26,023)
- (5)
- (1)
- (4)
- (582)
- (2)
- (1)
- (1)
- (3)
- (1)
- (1)
- (14)
- (32)
- (24)
- (1)
- (2)
- (16)
- (120)
- (9)
- (2)
- (1)
- (2)
- (2)
- (2)
- (23)
- (5)
- (3)
- (3)
- (2)
- (14)
- (23,575)
- (1)
- (48)
Conjugate
- (7)
- (1)
- (3)
- (18)
- (2)
- (62)
- (1)
- (4)
- (2)
- (9)
- (59)
- (1)
- (2)
- (3)
- (1)
- (391)
- (1)
- (3)
- (2)
- (1)
- (1)
- (1)
- (3)
- (2)
- (6)
- (19)
- (7)
- (2)
- (2)
- (3)
- (45)
- (1)
- (1)
- (1)
- (2)
- (5)
- (1)
- (1)
- (1)
- (1)
- (2)
- (8)
- (2)
- (3)
- (38,961)
- (1)
- (11)
Filtered Search Results
Products from some of our suppliers do not display in filtered search results. Please
clear all filters
to see these products.
Keyword Search:
Clear search
1,981
–
1,995
of
115,704
results
R&D Systems™ Recombinant Human CD97 His-tag Protein
CD97 is a member of the epidermal growth factor-seven transmembrane (EGF-TM7) subfamily of G-protein coupled receptors
Novus Biologicals™ Recombinant Human mu Crystallin His Protein
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Highly purified. Generating reliable and reproducible results.
R&D Systems™ Recombinant Mouse Semaphorin 3C Fc Chimera (Truncated)
Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility. Applications: Bioactivity
Novus Biologicals™ Recombinant Human PSMA8 His Protein
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Highly purified. Generating reliable and reproducible results.
Novus Biologicals™ Recombinant Human Histone Deacetylase 2/HDAC2 His Protein
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Highly purified. Generating reliable and reproducible results. Applications: SDS-Page
R&D Systems™ Recombinant Human Lymphotoxin alpha1/beta2 Avi Protein
Measured by its binding ability in a functional ELISA.
R&D Systems™ Recombinant Cynomolgus CD48/SLAMF2 Fc Chimera Protein
Measured by its binding ability in a functional ELISA.
Novus Biologicals™ VILIP3 Protein
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Highly purified. Generating reliable and reproducible results.
| Regulatory Status | RUO |
|---|---|
| Purification Method | Protein |
| Purity or Quality Grade | >95% |
| Conjugate | Unconjugated |
| Common Name | VILIP3 |
| Molecular Weight (g/mol) | 24.4kDa |
| Gene ID (Entrez) | 3241 |
| Formulation | Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 0.2M NaCl 1mM DTT, 10% glycerol |
| Immunogen | VILIP3, aka HPCAL1, 1-193 aa, with an N-terminal HIS tag. MGSSHHHHHHSSGLVPRGSHMGKQNSKLRPEVLQDLRENTEFTDHELQEWYKGFLKDCPTGHLTVDEFKKIYANFFPYGDASKFAEHVFRTFDTNGDGTIDFREFIIALSVTSRGKLEQKLKWAFSMYDLDGNGYISRSEMLEIVQAIYKMVSSVMKMPEDESTPEKRTDKIFRQMDTNNDGKLSLEEFIRGAKSDPSIVRLLQCDPSSASQF |
| Storage Requirements | Store at -80°C. Avoid freeze-thaw cycles. |
| Concentration | 0.5mg/mL |
| For Use With (Application) | ELISA,SDS-PAGE |
| Source | Human |
| Regulatory Status | RUO |
|---|---|
| Purity or Quality Grade | >95%, by SDS-PAGE under reducing conditions |
| Conjugate | Unconjugated |
| Form | Liquid |
| Formulation | 25 mM sodium acetate with 50% glycerol and no preservative; pH 4.8 |
| Sequence | Amino acids Asp31-Ile328 containing an N-terminal His-tag |
| Concentration | 0.29 mg/mL |
| For Use With (Application) | Control,Western Blot |
| Source | E. coli |
| Name | Human VEGFR1 |
| Recombinant | Recombinant |
| Regulatory Status | RUO |
|---|---|
| Purity or Quality Grade | >95%, by SDS-PAGE under reducing conditions |
| Conjugate | Unconjugated |
| Form | Liquid |
| Formulation | 20 mM tris HCl with 50% glycerol and no preservative; pH 8 |
| Sequence | Amino acids Glu19-Leu201 containing an N-terminal His-tag |
| Concentration | 1.0 mg/mL |
| For Use With (Application) | Control,Western Blot |
| Source | E. coli |
| Name | Human RBP4 |
| Recombinant | Recombinant |
| Regulatory Status | RUO |
|---|---|
| Purity or Quality Grade | >95%, by SDS-PAGE under reducing conditions |
| Conjugate | Unconjugated |
| Form | Liquid |
| Formulation | 10 mM Bis-tris propane with 50% glycerol, 62.5 mM NaCl and no preservative; pH 9 |
| Sequence | Amino acids Leu35-Leu205 containing an N-terminal His-tag |
| For Use With (Application) | Control,Western Blot |
| Source | E. Coli |
| Name | Human TNF-beta |
| Recombinant | Recombinant |
| Regulatory Status | RUO |
|---|---|
| Purity or Quality Grade | >95%, by SDS-PAGE under reducing conditions |
| Conjugate | Unconjugated |
| Form | Liquid |
| Formulation | PBS with 50% glycerol and no preservative; pH 7.4 |
| Sequence | Amino acids Ser2-Glu92 containing an N-terminal His-tag |
| Concentration | 0.5 mg/mL |
| For Use With (Application) | Control,Western Blot |
| Source | E. coli |
| Name | Human S100B |
| Recombinant | Recombinant |
| Regulatory Status | RUO |
|---|---|
| Purity or Quality Grade | >95%, by SDS-PAGE under reducing conditions |
| Conjugate | Unconjugated |
| Form | Liquid |
| Molecular Weight (g/mol) | 25.21 kDa |
| Formulation | 25 mM sodium acetate with 50% glycerol and no preservative; pH 4.8 |
| Sequence | Amino acids Cys24-Ala207 containing an N-terminal His-tag |
| Concentration | 0.29 mg/mL |
| For Use With (Application) | Control,Western Blot |
| Source | E. Coli |
| Name | Human TIMP1 |
| Recombinant | Recombinant |
| Regulatory Status | RUO |
|---|---|
| Purity or Quality Grade | >95%, by SDS-PAGE under reducing conditions |
| Conjugate | Unconjugated |
| Form | Liquid |
| Formulation | 25 mM sodium acetate with 50% glycerol and no preservative; pH 4.8 |
| Sequence | Amino acids Asp31-Ile328 containing an N-terminal His-tag |
| Concentration | 0.29 mg/mL |
| For Use With (Application) | Control,Western Blot |
| Source | E. coli |
| Name | Human VEGFR1 |
| Recombinant | Recombinant |
| Regulatory Status | RUO |
|---|---|
| Purity or Quality Grade | >95%, by SDS-PAGE under reducing conditions |
| Conjugate | Unconjugated |
| Form | Liquid |
| Molecular Weight (g/mol) | 24.76 kDa |
| Formulation | 10 mM tris HCl with 50% glycerol, 62.5 mM NaCl and no preservative; pH 8 |
| Sequence | Amino acids Ala21-Arg200 containing an N-terminal His-tag |
| Concentration | 0.25 mg/mL |
| For Use With (Application) | Control,Western Blot |
| Source | E. coli |
| Name | Human TREM-1 |
| Recombinant | Recombinant |